Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for fishercat 101. fishercat Lv 1 5 pts. 8,746
  2. Avatar for jermainiac 102. jermainiac Lv 1 5 pts. 8,740
  3. Avatar for severin333 103. severin333 Lv 1 5 pts. 8,739
  4. Avatar for NinjaGreg 104. NinjaGreg Lv 1 4 pts. 8,730
  5. Avatar for eusair 105. eusair Lv 1 4 pts. 8,720
  6. Avatar for altejoh 106. altejoh Lv 1 4 pts. 8,720
  7. Avatar for eragon50714 107. eragon50714 Lv 1 4 pts. 8,708
  8. Avatar for TomTaylor 108. TomTaylor Lv 1 4 pts. 8,706
  9. Avatar for pandapharmd 109. pandapharmd Lv 1 4 pts. 8,706
  10. Avatar for Arne Heessels 110. Arne Heessels Lv 1 3 pts. 8,705

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)