Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for Imeturoran 111. Imeturoran Lv 1 3 pts. 8,704
  2. Avatar for Hollinas 112. Hollinas Lv 1 3 pts. 8,701
  3. Avatar for ViJay7019 113. ViJay7019 Lv 1 3 pts. 8,700
  4. Avatar for turbolag 114. turbolag Lv 1 3 pts. 8,697
  5. Avatar for placid.lion 115. placid.lion Lv 1 3 pts. 8,681
  6. Avatar for Skippysk8s 116. Skippysk8s Lv 1 3 pts. 8,664
  7. Avatar for uihcv 117. uihcv Lv 1 3 pts. 8,658
  8. Avatar for Kiwegapa 118. Kiwegapa Lv 1 2 pts. 8,655
  9. Avatar for rinze 119. rinze Lv 1 2 pts. 8,646
  10. Avatar for bullmoose3 120. bullmoose3 Lv 1 2 pts. 8,643

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)