Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for tweak64 121. tweak64 Lv 1 2 pts. 8,643
  2. Avatar for Auntecedent 122. Auntecedent Lv 1 2 pts. 8,642
  3. Avatar for Bautho 123. Bautho Lv 1 2 pts. 8,637
  4. Avatar for mitarcher 124. mitarcher Lv 1 2 pts. 8,631
  5. Avatar for xplocast1 125. xplocast1 Lv 1 2 pts. 8,621
  6. Avatar for pfirth 126. pfirth Lv 1 2 pts. 8,617
  7. Avatar for senor pit 127. senor pit Lv 1 2 pts. 8,614
  8. Avatar for ManVsYard 128. ManVsYard Lv 1 2 pts. 8,608
  9. Avatar for meatexplosion 129. meatexplosion Lv 1 2 pts. 8,606
  10. Avatar for leehaggis 130. leehaggis Lv 1 2 pts. 8,598

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)