Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for martinf 131. martinf Lv 1 1 pt. 8,598
  2. Avatar for lockert 132. lockert Lv 1 1 pt. 8,569
  3. Avatar for demeter900 133. demeter900 Lv 1 1 pt. 8,564
  4. Avatar for racingsnailrider 134. racingsnailrider Lv 1 1 pt. 8,563
  5. Avatar for pizpot 135. pizpot Lv 1 1 pt. 8,549
  6. Avatar for Nick_Flamel 136. Nick_Flamel Lv 1 1 pt. 8,541
  7. Avatar for Ref_Jo 137. Ref_Jo Lv 1 1 pt. 8,537
  8. Avatar for pyrophoenix100 138. pyrophoenix100 Lv 1 1 pt. 8,536
  9. Avatar for poiuyqwert 139. poiuyqwert Lv 1 1 pt. 8,536
  10. Avatar for xiaobashi 140. xiaobashi Lv 1 1 pt. 8,535

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)