Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for andrewxc 141. andrewxc Lv 1 1 pt. 8,528
  2. Avatar for DScott 142. DScott Lv 1 1 pt. 8,510
  3. Avatar for justjustin 143. justjustin Lv 1 1 pt. 8,488
  4. Avatar for leannerikicheever 144. leannerikicheever Lv 1 1 pt. 8,478
  5. Avatar for ZiiONIC 145. ZiiONIC Lv 1 1 pt. 8,472
  6. Avatar for shereng 146. shereng Lv 1 1 pt. 8,466
  7. Avatar for aendgraend 147. aendgraend Lv 1 1 pt. 8,466
  8. Avatar for monkry 148. monkry Lv 1 1 pt. 8,458
  9. Avatar for parsnip 149. parsnip Lv 1 1 pt. 8,454
  10. Avatar for NotJim99 150. NotJim99 Lv 1 1 pt. 8,453

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)