Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for aspadistra 181. aspadistra Lv 1 1 pt. 8,294
  2. Avatar for Ciccillo 182. Ciccillo Lv 1 1 pt. 8,288
  3. Avatar for AEJensen 183. AEJensen Lv 1 1 pt. 8,285
  4. Avatar for Mutabis 184. Mutabis Lv 1 1 pt. 8,279
  5. Avatar for yoyoparis 185. yoyoparis Lv 1 1 pt. 8,272
  6. Avatar for boelze 186. boelze Lv 1 1 pt. 8,268
  7. Avatar for BubbaGecko 187. BubbaGecko Lv 1 1 pt. 8,266
  8. Avatar for sor2018 188. sor2018 Lv 1 1 pt. 8,241
  9. Avatar for mirjamvandelft 189. mirjamvandelft Lv 1 1 pt. 8,229
  10. Avatar for Deleted player 190. Deleted player 1 pt. 8,229

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)