Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for Gaviner 191. Gaviner Lv 1 1 pt. 8,222
  2. Avatar for krisha_lim 192. krisha_lim Lv 1 1 pt. 8,217
  3. Avatar for 7ships 193. 7ships Lv 1 1 pt. 8,206
  4. Avatar for pressthebutton 194. pressthebutton Lv 1 1 pt. 8,204
  5. Avatar for Snodlop 195. Snodlop Lv 1 1 pt. 8,200
  6. Avatar for saksoft2 196. saksoft2 Lv 1 1 pt. 8,193
  7. Avatar for EricLu 197. EricLu Lv 1 1 pt. 8,165
  8. Avatar for higashi0726 198. higashi0726 Lv 1 1 pt. 8,165
  9. Avatar for TheEnderCavalier 199. TheEnderCavalier Lv 1 1 pt. 8,070
  10. Avatar for phi16 200. phi16 Lv 1 1 pt. 7,987

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)