Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0
  3. Avatar for Natural Abilities 23. Natural Abilities 1 pt. 0
  1. Avatar for emdee314 201. emdee314 Lv 1 1 pt. 7,956
  2. Avatar for leaston 202. leaston Lv 1 1 pt. 7,849
  3. Avatar for MadChemTeacher 203. MadChemTeacher Lv 1 1 pt. 7,846
  4. Avatar for meta... 204. meta... Lv 1 1 pt. 7,616
  5. Avatar for demoncrap 205. demoncrap Lv 1 1 pt. 7,568
  6. Avatar for bendbob 206. bendbob Lv 1 1 pt. 7,053
  7. Avatar for mkurain 207. mkurain Lv 1 1 pt. 6,479
  8. Avatar for sanosuque 208. sanosuque Lv 1 1 pt. 4,208
  9. Avatar for jflat06 209. jflat06 Lv 1 1 pt. 0
  10. Avatar for Mr_Jolty 210. Mr_Jolty Lv 1 1 pt. 0

Comments

Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)