Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 62 pts. 8,959
  2. Avatar for frood66 22. frood66 Lv 1 60 pts. 8,958
  3. Avatar for Galaxie 23. Galaxie Lv 1 59 pts. 8,957
  4. Avatar for reefyrob 24. reefyrob Lv 1 57 pts. 8,956
  5. Avatar for bertro 25. bertro Lv 1 56 pts. 8,954
  6. Avatar for Blipperman 26. Blipperman Lv 1 54 pts. 8,949
  7. Avatar for dembones 27. dembones Lv 1 53 pts. 8,941
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 52 pts. 8,939
  9. Avatar for kabubi 29. kabubi Lv 1 50 pts. 8,935
  10. Avatar for Satina 30. Satina Lv 1 49 pts. 8,935

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)