Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for Merf 41. Merf Lv 1 36 pts. 8,897
  2. Avatar for johngran 42. johngran Lv 1 35 pts. 8,896
  3. Avatar for joremen 43. joremen Lv 1 34 pts. 8,892
  4. Avatar for Vredeman 44. Vredeman Lv 1 33 pts. 8,892
  5. Avatar for pmdpmd 45. pmdpmd Lv 1 32 pts. 8,891
  6. Avatar for SKSbell 46. SKSbell Lv 1 31 pts. 8,889
  7. Avatar for JayD7217 47. JayD7217 Lv 1 31 pts. 8,889
  8. Avatar for caglar 48. caglar Lv 1 30 pts. 8,887
  9. Avatar for Rhyslarn 49. Rhyslarn Lv 1 29 pts. 8,886
  10. Avatar for alcor29 50. alcor29 Lv 1 28 pts. 8,884

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)