Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for INFINITAS 21. INFINITAS 1 pt. 8,200
  2. Avatar for Window Group 22. Window Group 1 pt. 0

  1. Avatar for Anfinsen_slept_here 61. Anfinsen_slept_here Lv 1 20 pts. 8,861
  2. Avatar for ZeroLeak7 62. ZeroLeak7 Lv 1 19 pts. 8,861
  3. Avatar for gurch 63. gurch Lv 1 19 pts. 8,859
  4. Avatar for weitzen 64. weitzen Lv 1 18 pts. 8,858
  5. Avatar for carsonfb 65. carsonfb Lv 1 18 pts. 8,852
  6. Avatar for Alistair69 66. Alistair69 Lv 1 17 pts. 8,848
  7. Avatar for Deleted player 67. Deleted player 16 pts. 8,845
  8. Avatar for martin.szew 68. martin.szew Lv 1 16 pts. 8,845
  9. Avatar for YeshuaLives 69. YeshuaLives Lv 1 15 pts. 8,838
  10. Avatar for Bushman 70. Bushman Lv 1 15 pts. 8,836

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)