1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Summary

• Created: October 18, 2016
• Expires: October 26, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

• 1. Anthropic Dreams 100 pts. 9,009
• 2. Contenders 80 pts. 9,000
• 3. Go Science 63 pts. 8,991
• 4. Beta Folders 49 pts. 8,990
• 5. L'Alliance Francophone 37 pts. 8,990
• 6. Void Crushers 28 pts. 8,981
• 7. Gargleblasters 21 pts. 8,971
• 8. HMT heritage 15 pts. 8,969
• 9. Italiani Al Lavoro 11 pts. 8,836
• 10. xkcd 8 pts. 8,833

Top evolvers

• 1. Galaxie 100 pts. 9,009
• 2. Deleted player pts. 9,008
• 3. dembones 76 pts. 9,000
• 4. georg137 65 pts. 8,999
• 5. gitwut 56 pts. 8,999
• 6. jermainiac 48 pts. 8,996
• 7. lamoille 41 pts. 8,994
• 8. diamond_dust 34 pts. 8,991
• 9. smilingone 29 pts. 8,988
• 10. alwen 24 pts. 8,987

Comments

[Aubade01]

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)