1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 9 years ago

Summary

• Created: October 18, 2016
• Expires: October 26, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

• 1. Anthropic Dreams 100 pts. 9,009
• 2. Contenders 80 pts. 9,000
• 3. Go Science 63 pts. 8,991
• 4. Beta Folders 49 pts. 8,990
• 5. L'Alliance Francophone 37 pts. 8,990
• 6. Void Crushers 28 pts. 8,981
• 7. Gargleblasters 21 pts. 8,971
• 8. HMT heritage 15 pts. 8,969
• 9. Italiani Al Lavoro 11 pts. 8,836
• 10. xkcd 8 pts. 8,833

Top soloists

• 11. pauldunn 79 pts. 8,982
• 12. Timo van der Laan 77 pts. 8,981
• 13. smilingone 76 pts. 8,978
• 14. mimi 74 pts. 8,976
• 15. fiendish_ghoul 72 pts. 8,973
• 16. crpainter 70 pts. 8,969
• 17. O Seki To 68 pts. 8,969
• 18. Mike Lewis 67 pts. 8,966
• 19. Keresto 65 pts. 8,964
• 20. Bruno Kestemont 63 pts. 8,961

Comments

[Aubade01]

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)