Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Deleted group 14. Deleted group pts. 6,871
  4. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  5. Avatar for Russian team 16. Russian team 1 pt. 5,907
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,661
  2. Avatar for Scopper 2. Scopper Lv 1 98 pts. 9,517
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 95 pts. 9,507
  4. Avatar for Deleted player 4. Deleted player pts. 9,487
  5. Avatar for Mark- 5. Mark- Lv 1 90 pts. 9,484
  6. Avatar for johnmitch 6. johnmitch Lv 1 88 pts. 9,480
  7. Avatar for frood66 7. frood66 Lv 1 85 pts. 9,480
  8. Avatar for tokens 8. tokens Lv 1 83 pts. 9,477
  9. Avatar for Susume 9. Susume Lv 1 81 pts. 9,476
  10. Avatar for dembones 10. dembones Lv 1 78 pts. 9,467

Comments