Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 7,783
  2. Avatar for BiboKids 12. BiboKids 1 pt. 7,413
  3. Avatar for Freeport Honors Biology 13. Freeport Honors Biology 1 pt. 7,124
  4. Avatar for Deleted group 14. Deleted group pts. 6,871
  5. Avatar for AST Biology 15. AST Biology 1 pt. 6,281
  6. Avatar for Russian team 16. Russian team 1 pt. 5,907
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,465
  1. Avatar for dembones
    1. dembones Lv 1
    100 pts. 9,530
  2. Avatar for gitwut 2. gitwut Lv 1 86 pts. 9,527
  3. Avatar for mimi 3. mimi Lv 1 73 pts. 9,519
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 62 pts. 9,516
  5. Avatar for Hollinas 5. Hollinas Lv 1 52 pts. 9,516
  6. Avatar for georg137 6. georg137 Lv 1 43 pts. 9,500
  7. Avatar for actiasluna 7. actiasluna Lv 1 36 pts. 9,495
  8. Avatar for Blipperman 8. Blipperman Lv 1 30 pts. 9,495
  9. Avatar for Galaxie 9. Galaxie Lv 1 24 pts. 9,494
  10. Avatar for JayD7217 10. JayD7217 Lv 1 20 pts. 9,494

Comments