Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Contenders 100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464

  1. Avatar for tomespen 11. tomespen Lv 1 16 pts. 9,492
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 13 pts. 9,490
  3. Avatar for Cyberkashi 13. Cyberkashi Lv 1 10 pts. 9,488
  4. Avatar for lamoille 14. lamoille Lv 1 8 pts. 9,487
  5. Avatar for ManVsYard 15. ManVsYard Lv 1 6 pts. 9,483
  6. Avatar for jamiexq 16. jamiexq Lv 1 5 pts. 9,481
  7. Avatar for Deleted player 17. Deleted player pts. 9,480
  8. Avatar for alwen 18. alwen Lv 1 3 pts. 9,480
  9. Avatar for reefyrob 19. reefyrob Lv 1 2 pts. 9,468
  10. Avatar for LociOiling 20. LociOiling Lv 1 2 pts. 9,466

Comments