Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for smilingone 21. smilingone Lv 1 1 pt. 9,464
  2. Avatar for ViJay7019 22. ViJay7019 Lv 1 1 pt. 9,457
  3. Avatar for Sporeo 23. Sporeo Lv 1 1 pt. 9,454
  4. Avatar for Steven Pletsch 24. Steven Pletsch Lv 1 1 pt. 9,445
  5. Avatar for Deleted player 25. Deleted player pts. 9,437
  6. Avatar for Keresto 26. Keresto Lv 1 1 pt. 9,436
  7. Avatar for alcor29 27. alcor29 Lv 1 1 pt. 9,432
  8. Avatar for jermainiac 28. jermainiac Lv 1 1 pt. 9,432
  9. Avatar for retiredmichael 29. retiredmichael Lv 1 1 pt. 9,419
  10. Avatar for Psych0Active 30. Psych0Active Lv 1 1 pt. 9,415

Comments