Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups


  1. Avatar for Contenders 100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,661
  2. Avatar for Scopper 2. Scopper Lv 1 98 pts. 9,517
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 95 pts. 9,507
  4. Avatar for Deleted player 4. Deleted player pts. 9,487
  5. Avatar for Mark- 5. Mark- Lv 1 90 pts. 9,484
  6. Avatar for johnmitch 6. johnmitch Lv 1 88 pts. 9,480
  7. Avatar for frood66 7. frood66 Lv 1 85 pts. 9,480
  8. Avatar for tokens 8. tokens Lv 1 83 pts. 9,477
  9. Avatar for Susume 9. Susume Lv 1 81 pts. 9,476
  10. Avatar for dembones 10. dembones Lv 1 78 pts. 9,467

Comments