Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,219
  2. Avatar for markm457 2. markm457 Lv 1 98 pts. 9,196
  3. Avatar for LociOiling 3. LociOiling Lv 1 96 pts. 9,186
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 94 pts. 9,186
  5. Avatar for tokens 5. tokens Lv 1 92 pts. 9,174
  6. Avatar for hansvandenhof 6. hansvandenhof Lv 1 90 pts. 9,167
  7. Avatar for Reldas 7. Reldas Lv 1 88 pts. 9,164
  8. Avatar for bertro 8. bertro Lv 1 86 pts. 9,144
  9. Avatar for Deleted player 9. Deleted player pts. 9,133
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 82 pts. 9,128

Comments