Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731

  1. Avatar for altejoh 91. altejoh Lv 1 8 pts. 8,787
  2. Avatar for bx7gn 92. bx7gn Lv 1 8 pts. 8,787
  3. Avatar for Alistair69 93. Alistair69 Lv 1 8 pts. 8,786
  4. Avatar for gurch 94. gurch Lv 1 7 pts. 8,786
  5. Avatar for Norrjane 95. Norrjane Lv 1 7 pts. 8,785
  6. Avatar for Bushman 96. Bushman Lv 1 7 pts. 8,774
  7. Avatar for JayD7217 97. JayD7217 Lv 1 7 pts. 8,769
  8. Avatar for mitarcher 98. mitarcher Lv 1 6 pts. 8,768
  9. Avatar for O Seki To 99. O Seki To Lv 1 6 pts. 8,761
  10. Avatar for Geyalust 100. Geyalust Lv 1 6 pts. 8,755

Comments