Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731

  1. Avatar for johngran 111. johngran Lv 1 4 pts. 8,705
  2. Avatar for TastyMunchies 112. TastyMunchies Lv 1 4 pts. 8,703
  3. Avatar for cobaltteal 113. cobaltteal Lv 1 4 pts. 8,695
  4. Avatar for deLaCeiba 114. deLaCeiba Lv 1 4 pts. 8,694
  5. Avatar for Arne Heessels 115. Arne Heessels Lv 1 3 pts. 8,677
  6. Avatar for kaltluftballon 116. kaltluftballon Lv 1 3 pts. 8,672
  7. Avatar for Rhyslarn 117. Rhyslarn Lv 1 3 pts. 8,670
  8. Avatar for monkry 118. monkry Lv 1 3 pts. 8,666
  9. Avatar for kcy0511 119. kcy0511 Lv 1 3 pts. 8,660
  10. Avatar for fishercat 120. fishercat Lv 1 3 pts. 8,658

Comments