Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731
  1. Avatar for Ref_Jo 131. Ref_Jo Lv 1 2 pts. 8,603
  2. Avatar for SouperGenious 132. SouperGenious Lv 1 2 pts. 8,598
  3. Avatar for navn 133. navn Lv 1 2 pts. 8,592
  4. Avatar for FishKAA 134. FishKAA Lv 1 2 pts. 8,588
  5. Avatar for rinze 135. rinze Lv 1 2 pts. 8,587
  6. Avatar for ViJay7019 136. ViJay7019 Lv 1 2 pts. 8,577
  7. Avatar for bullmoose3 137. bullmoose3 Lv 1 1 pt. 8,572
  8. Avatar for placid.lion 138. placid.lion Lv 1 1 pt. 8,562
  9. Avatar for Iron pet 139. Iron pet Lv 1 1 pt. 8,561
  10. Avatar for benrh 140. benrh Lv 1 1 pt. 8,558

Comments