Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731

  1. Avatar for DScott 181. DScott Lv 1 1 pt. 8,153
  2. Avatar for commander_white 182. commander_white Lv 1 1 pt. 8,153
  3. Avatar for ElijahHumphries 183. ElijahHumphries Lv 1 1 pt. 8,150
  4. Avatar for IBBIOBRI 184. IBBIOBRI Lv 1 1 pt. 8,149
  5. Avatar for angelsinad 185. angelsinad Lv 1 1 pt. 8,144
  6. Avatar for Johnne98 186. Johnne98 Lv 1 1 pt. 8,140
  7. Avatar for KantiSH 187. KantiSH Lv 1 1 pt. 8,134
  8. Avatar for gondust 188. gondust Lv 1 1 pt. 8,130
  9. Avatar for Gussep 189. Gussep Lv 1 1 pt. 8,130
  10. Avatar for matt.matu 190. matt.matu Lv 1 1 pt. 8,128

Comments