Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731
  1. Avatar for hat 211. hat Lv 1 1 pt. 7,906
  2. Avatar for dantedum 212. dantedum Lv 1 1 pt. 7,873
  3. Avatar for kurel 213. kurel Lv 1 1 pt. 7,815
  4. Avatar for mallansohn 214. mallansohn Lv 1 1 pt. 7,731
  5. Avatar for racingsnailrider 215. racingsnailrider Lv 1 1 pt. 7,729
  6. Avatar for Flagg65a 216. Flagg65a Lv 1 1 pt. 7,635
  7. Avatar for 01010011111 217. 01010011111 Lv 1 1 pt. 7,608
  8. Avatar for xplocast1 218. xplocast1 Lv 1 1 pt. 7,602
  9. Avatar for Ekoue 219. Ekoue Lv 1 1 pt. 7,597
  10. Avatar for xingjiepan 220. xingjiepan Lv 1 1 pt. 7,480

Comments