Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731
  1. Avatar for crpainter 21. crpainter Lv 1 63 pts. 9,068
  2. Avatar for frood66 22. frood66 Lv 1 62 pts. 9,067
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 60 pts. 9,064
  4. Avatar for grogar7 24. grogar7 Lv 1 59 pts. 9,063
  5. Avatar for pauldunn 25. pauldunn Lv 1 57 pts. 9,062
  6. Avatar for Galaxie 26. Galaxie Lv 1 56 pts. 9,057
  7. Avatar for gmn 27. gmn Lv 1 55 pts. 9,056
  8. Avatar for jermainiac 28. jermainiac Lv 1 53 pts. 9,054
  9. Avatar for Steven Pletsch 29. Steven Pletsch Lv 1 52 pts. 9,054
  10. Avatar for TomTaylor 30. TomTaylor Lv 1 51 pts. 9,050

Comments