Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731

  1. Avatar for Vinara 41. Vinara Lv 1 38 pts. 8,999
  2. Avatar for guineapig 42. guineapig Lv 1 37 pts. 8,992
  3. Avatar for Bletchley Park 43. Bletchley Park Lv 1 36 pts. 8,990
  4. Avatar for Deleted player 44. Deleted player pts. 8,985
  5. Avatar for christioanchauvin 45. christioanchauvin Lv 1 34 pts. 8,977
  6. Avatar for pmdpmd 46. pmdpmd Lv 1 33 pts. 8,971
  7. Avatar for ralan-nsk 47. ralan-nsk Lv 1 32 pts. 8,970
  8. Avatar for Sporeo 48. Sporeo Lv 1 31 pts. 8,967
  9. Avatar for nicobul 49. nicobul Lv 1 31 pts. 8,964
  10. Avatar for Blipperman 50. Blipperman Lv 1 30 pts. 8,959

Comments