Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731

  1. Avatar for NinjaGreg 71. NinjaGreg Lv 1 16 pts. 8,872
  2. Avatar for Tehnologik1 72. Tehnologik1 Lv 1 16 pts. 8,869
  3. Avatar for SaraL 73. SaraL Lv 1 15 pts. 8,865
  4. Avatar for eromana 74. eromana Lv 1 15 pts. 8,863
  5. Avatar for alcor29 75. alcor29 Lv 1 14 pts. 8,847
  6. Avatar for Deleted player 76. Deleted player pts. 8,847
  7. Avatar for Glen B 77. Glen B Lv 1 13 pts. 8,845
  8. Avatar for froggs554 78. froggs554 Lv 1 13 pts. 8,843
  9. Avatar for pfirth 79. pfirth Lv 1 12 pts. 8,843
  10. Avatar for tallguy-13088 80. tallguy-13088 Lv 1 12 pts. 8,842

Comments