Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,196
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,186
  3. Avatar for Gargleblasters 3. Gargleblasters 63 pts. 9,139
  4. Avatar for Go Science 4. Go Science 49 pts. 9,126
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,111
  6. Avatar for Contenders 6. Contenders 28 pts. 9,103
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,077
  8. Avatar for Deleted group 8. Deleted group pts. 9,054
  9. Avatar for Russian team 9. Russian team 11 pts. 8,970
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 8 pts. 8,945

  1. Avatar for emdee314 191. emdee314 Lv 1 1 pt. 8,126
  2. Avatar for Olyndar2 192. Olyndar2 Lv 1 1 pt. 8,125
  3. Avatar for Cerzax 193. Cerzax Lv 1 1 pt. 8,119
  4. Avatar for FroggyGremlin 194. FroggyGremlin Lv 1 1 pt. 8,117
  5. Avatar for Gomario 195. Gomario Lv 1 1 pt. 8,096
  6. Avatar for smarthuman 196. smarthuman Lv 1 1 pt. 8,090
  7. Avatar for notfoldme 197. notfoldme Lv 1 1 pt. 8,081
  8. Avatar for janemerca08 198. janemerca08 Lv 1 1 pt. 8,077
  9. Avatar for jenduimering 199. jenduimering Lv 1 1 pt. 8,056
  10. Avatar for arian77 200. arian77 Lv 1 1 pt. 8,053

Comments