Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,490
  2. Avatar for Aubade01 2. Aubade01 Lv 1 98 pts. 9,471
  3. Avatar for LociOiling 3. LociOiling Lv 1 96 pts. 9,471
  4. Avatar for markm457 4. markm457 Lv 1 94 pts. 9,452
  5. Avatar for dembones 5. dembones Lv 1 91 pts. 9,439
  6. Avatar for tokens 6. tokens Lv 1 89 pts. 9,423
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 87 pts. 9,411
  8. Avatar for pmdpmd 8. pmdpmd Lv 1 85 pts. 9,403
  9. Avatar for Vredeman 9. Vredeman Lv 1 83 pts. 9,400
  10. Avatar for gitwut 10. gitwut Lv 1 81 pts. 9,393

Comments