1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Summary

• Created: December 11, 2016
• Expires: December 20, 2016 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

• 1. Go Science 100 pts. 9,490
• 2. Beta Folders 77 pts. 9,471
• 3. Anthropic Dreams 58 pts. 9,453
• 4. Contenders 43 pts. 9,439
• 5. L'Alliance Francophone 31 pts. 9,403
• 6. Void Crushers 22 pts. 9,384
• 7. Deleted group pts. 9,360
• 8. Gargleblasters 11 pts. 9,312
• 9. HMT heritage 7 pts. 9,192
• 10. :) 5 pts. 9,120

Top evolvers

• 1. Bruno Kestemont 100 pts. 9,490
• 2. Hollinas 85 pts. 9,489
• 3. pauldunn 71 pts. 9,479
• 4. JayD7217 60 pts. 9,472
• 5. smilingone 49 pts. 9,461
• 6. reefyrob 41 pts. 9,458
• 7. Galaxie 33 pts. 9,453
• 8. Vredeman 27 pts. 9,449
• 9. lamoille 22 pts. 9,447
• 10. phi16 17 pts. 9,443