Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120
  1. Avatar for Ikuso 111. Ikuso Lv 1 3 pts. 9,014
  2. Avatar for Ref_Jo 112. Ref_Jo Lv 1 3 pts. 9,001
  3. Avatar for Apolloid 113. Apolloid Lv 1 3 pts. 8,993
  4. Avatar for ppp6 114. ppp6 Lv 1 3 pts. 8,986
  5. Avatar for senor pit 115. senor pit Lv 1 2 pts. 8,985
  6. Avatar for cjreinholt 116. cjreinholt Lv 1 2 pts. 8,975
  7. Avatar for deLaCeiba 117. deLaCeiba Lv 1 2 pts. 8,969
  8. Avatar for rezaefar 118. rezaefar Lv 1 2 pts. 8,964
  9. Avatar for ManVsYard 119. ManVsYard Lv 1 2 pts. 8,964
  10. Avatar for tweak64 120. tweak64 Lv 1 2 pts. 8,959

Comments