Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120

  1. Avatar for Iron pet 131. Iron pet Lv 1 1 pt. 8,875
  2. Avatar for Cerzax 132. Cerzax Lv 1 1 pt. 8,875
  3. Avatar for DScott 133. DScott Lv 1 1 pt. 8,860
  4. Avatar for placid.lion 134. placid.lion Lv 1 1 pt. 8,857
  5. Avatar for altejoh 135. altejoh Lv 1 1 pt. 8,854
  6. Avatar for momadoc 136. momadoc Lv 1 1 pt. 8,833
  7. Avatar for pmelzer 137. pmelzer Lv 1 1 pt. 8,827
  8. Avatar for khendarg 138. khendarg Lv 1 1 pt. 8,820
  9. Avatar for badgoes 139. badgoes Lv 1 1 pt. 8,814
  10. Avatar for uihcv 140. uihcv Lv 1 1 pt. 8,784

Comments