Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120

  1. Avatar for boctothorpe 151. boctothorpe Lv 1 1 pt. 8,621
  2. Avatar for drumpeter18yrs9yrs 152. drumpeter18yrs9yrs Lv 1 1 pt. 8,620
  3. Avatar for xabxs 153. xabxs Lv 1 1 pt. 8,573
  4. Avatar for micheldeweerd 154. micheldeweerd Lv 1 1 pt. 8,564
  5. Avatar for Sylva 156. Sylva Lv 1 1 pt. 8,525
  6. Avatar for rmc.gabhainn 157. rmc.gabhainn Lv 1 1 pt. 8,519
  7. Avatar for 01010011111 158. 01010011111 Lv 1 1 pt. 8,512
  8. Avatar for Sanetium 159. Sanetium Lv 1 1 pt. 8,503
  9. Avatar for Olyndar 160. Olyndar Lv 1 1 pt. 8,480

Comments