Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120

  1. Avatar for lamoille 171. lamoille Lv 1 1 pt. 8,382
  2. Avatar for tmts_jk 172. tmts_jk Lv 1 1 pt. 8,367
  3. Avatar for Claudio.Gennari 173. Claudio.Gennari Lv 1 1 pt. 8,356
  4. Avatar for nielrocha96 174. nielrocha96 Lv 1 1 pt. 8,349
  5. Avatar for 3poke 175. 3poke Lv 1 1 pt. 8,338
  6. Avatar for sor2018 176. sor2018 Lv 1 1 pt. 8,328
  7. Avatar for LordHansolo 177. LordHansolo Lv 1 1 pt. 8,308
  8. Avatar for silleo 178. silleo Lv 1 1 pt. 8,297
  9. Avatar for doctaven 179. doctaven Lv 1 1 pt. 8,293
  10. Avatar for chrisjq16 180. chrisjq16 Lv 1 1 pt. 8,225

Comments