Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120

  1. Avatar for aspadistra 181. aspadistra Lv 1 1 pt. 8,060
  2. Avatar for Atrus_Homeboy 182. Atrus_Homeboy Lv 1 1 pt. 8,041
  3. Avatar for racingsnailrider 183. racingsnailrider Lv 1 1 pt. 8,015
  4. Avatar for heyubob 184. heyubob Lv 1 1 pt. 8,001
  5. Avatar for ivalnic 185. ivalnic Lv 1 1 pt. 7,990
  6. Avatar for karost 186. karost Lv 1 1 pt. 7,976
  7. Avatar for connorfeltonfraser 187. connorfeltonfraser Lv 1 1 pt. 7,958
  8. Avatar for FlaviuRadulescu 188. FlaviuRadulescu Lv 1 1 pt. 7,935
  9. Avatar for bob1928 189. bob1928 Lv 1 1 pt. 7,922
  10. Avatar for Kiwegapa 190. Kiwegapa Lv 1 1 pt. 7,905

Comments