Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120

  1. Avatar for nkuehl2213 191. nkuehl2213 Lv 1 1 pt. 7,900
  2. Avatar for inkycatz 192. inkycatz Lv 1 1 pt. 7,864
  3. Avatar for blackfire34 193. blackfire34 Lv 1 1 pt. 7,842
  4. Avatar for Andres S. Rovalo 194. Andres S. Rovalo Lv 1 1 pt. 7,841
  5. Avatar for Susume 195. Susume Lv 1 1 pt. 7,708
  6. Avatar for courtneyetaylor 196. courtneyetaylor Lv 1 1 pt. 7,526
  7. Avatar for ScratchKid 197. ScratchKid Lv 1 1 pt. 7,518
  8. Avatar for akuk 198. akuk Lv 1 1 pt. 7,291
  9. Avatar for macastr9 199. macastr9 Lv 1 1 pt. 7,181
  10. Avatar for iceslayer 200. iceslayer Lv 1 1 pt. 5,461

Comments