Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120

  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 61 pts. 9,307
  2. Avatar for Deleted player 22. Deleted player pts. 9,302
  3. Avatar for bertro 23. bertro Lv 1 58 pts. 9,300
  4. Avatar for phi16 24. phi16 Lv 1 56 pts. 9,290
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 55 pts. 9,285
  6. Avatar for g_b 26. g_b Lv 1 53 pts. 9,283
  7. Avatar for mimi 27. mimi Lv 1 52 pts. 9,281
  8. Avatar for crpainter 28. crpainter Lv 1 51 pts. 9,262
  9. Avatar for kabubi 29. kabubi Lv 1 49 pts. 9,257
  10. Avatar for pvc78 30. pvc78 Lv 1 48 pts. 9,254

Comments