Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120

  1. Avatar for isaksson 41. isaksson Lv 1 35 pts. 9,212
  2. Avatar for Simek 42. Simek Lv 1 34 pts. 9,206
  3. Avatar for YeshuaLives 43. YeshuaLives Lv 1 33 pts. 9,205
  4. Avatar for caglar 44. caglar Lv 1 32 pts. 9,203
  5. Avatar for smilingone 45. smilingone Lv 1 31 pts. 9,200
  6. Avatar for O Seki To 46. O Seki To Lv 1 30 pts. 9,192
  7. Avatar for jobo0502 47. jobo0502 Lv 1 29 pts. 9,188
  8. Avatar for joremen 48. joremen Lv 1 28 pts. 9,185
  9. Avatar for Blipperman 49. Blipperman Lv 1 28 pts. 9,175
  10. Avatar for smholst 50. smholst Lv 1 27 pts. 9,167

Comments