Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  3. Avatar for freefolder 14. freefolder 1 pt. 8,318
  4. Avatar for xkcd 15. xkcd 1 pt. 8,123
  5. Avatar for :) 16. :) 1 pt. 8,110
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  7. Avatar for Russian team 18. Russian team 1 pt. 7,883
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,708
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 9,691
  3. Avatar for LociOiling 3. LociOiling Lv 1 96 pts. 9,673
  4. Avatar for bertro 4. bertro Lv 1 94 pts. 9,654
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 92 pts. 9,644
  6. Avatar for markm457 6. markm457 Lv 1 90 pts. 9,643
  7. Avatar for pauldunn 7. pauldunn Lv 1 88 pts. 9,630
  8. Avatar for frood66 8. frood66 Lv 1 86 pts. 9,616
  9. Avatar for Vredeman 9. Vredeman Lv 1 84 pts. 9,603
  10. Avatar for dembones 10. dembones Lv 1 82 pts. 9,595

Comments