Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  3. Avatar for freefolder 14. freefolder 1 pt. 8,318
  4. Avatar for xkcd 15. xkcd 1 pt. 8,123
  5. Avatar for :) 16. :) 1 pt. 8,110
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  7. Avatar for Russian team 18. Russian team 1 pt. 7,883
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732

  1. Avatar for FishKAA 111. FishKAA Lv 1 4 pts. 8,452
  2. Avatar for Savas 112. Savas Lv 1 4 pts. 8,425
  3. Avatar for JUMELLE54 113. JUMELLE54 Lv 1 4 pts. 8,407
  4. Avatar for florashaman 114. florashaman Lv 1 4 pts. 8,404
  5. Avatar for ppp6 115. ppp6 Lv 1 3 pts. 8,380
  6. Avatar for Psych0Active 116. Psych0Active Lv 1 3 pts. 8,374
  7. Avatar for navn 117. navn Lv 1 3 pts. 8,359
  8. Avatar for dizzywings 118. dizzywings Lv 1 3 pts. 8,348
  9. Avatar for leehaggis 119. leehaggis Lv 1 3 pts. 8,340
  10. Avatar for feand 120. feand Lv 1 3 pts. 8,327

Comments