Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  3. Avatar for freefolder 14. freefolder 1 pt. 8,318
  4. Avatar for xkcd 15. xkcd 1 pt. 8,123
  5. Avatar for :) 16. :) 1 pt. 8,110
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  7. Avatar for Russian team 18. Russian team 1 pt. 7,883
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732

  1. Avatar for Hollinas 131. Hollinas Lv 1 2 pts. 8,252
  2. Avatar for justjustin 132. justjustin Lv 1 2 pts. 8,249
  3. Avatar for rinze 133. rinze Lv 1 2 pts. 8,244
  4. Avatar for senor pit 134. senor pit Lv 1 2 pts. 8,241
  5. Avatar for khendarg 135. khendarg Lv 1 2 pts. 8,231
  6. Avatar for Darkly Deadpan 136. Darkly Deadpan Lv 1 2 pts. 8,219
  7. Avatar for Reldas 137. Reldas Lv 1 2 pts. 8,208
  8. Avatar for DScott 138. DScott Lv 1 1 pt. 8,187
  9. Avatar for tomespen 139. tomespen Lv 1 1 pt. 8,177
  10. Avatar for Iron pet 140. Iron pet Lv 1 1 pt. 8,175

Comments