Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  3. Avatar for freefolder 14. freefolder 1 pt. 8,318
  4. Avatar for xkcd 15. xkcd 1 pt. 8,123
  5. Avatar for :) 16. :) 1 pt. 8,110
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  7. Avatar for Russian team 18. Russian team 1 pt. 7,883
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732

  1. Avatar for parsnip 161. parsnip Lv 1 1 pt. 7,856
  2. Avatar for fryguy 162. fryguy Lv 1 1 pt. 7,829
  3. Avatar for Olyndar 163. Olyndar Lv 1 1 pt. 7,799
  4. Avatar for momadoc 164. momadoc Lv 1 1 pt. 7,780
  5. Avatar for napen123 165. napen123 Lv 1 1 pt. 7,777
  6. Avatar for Pietro MSB 166. Pietro MSB Lv 1 1 pt. 7,761
  7. Avatar for przemek112233 167. przemek112233 Lv 1 1 pt. 7,746
  8. Avatar for doctaven 168. doctaven Lv 1 1 pt. 7,732
  9. Avatar for jfryk 169. jfryk Lv 1 1 pt. 7,732
  10. Avatar for NotJim99 170. NotJim99 Lv 1 1 pt. 7,723

Comments