Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  3. Avatar for freefolder 14. freefolder 1 pt. 8,318
  4. Avatar for xkcd 15. xkcd 1 pt. 8,123
  5. Avatar for :) 16. :) 1 pt. 8,110
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  7. Avatar for Russian team 18. Russian team 1 pt. 7,883
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732

  1. Avatar for Puttering 181. Puttering Lv 1 1 pt. 7,615
  2. Avatar for rmc.gabhainn 182. rmc.gabhainn Lv 1 1 pt. 7,615
  3. Avatar for colsonsi 183. colsonsi Lv 1 1 pt. 7,609
  4. Avatar for shroeder 184. shroeder Lv 1 1 pt. 7,598
  5. Avatar for byewelt 186. byewelt Lv 1 1 pt. 7,582
  6. Avatar for FadingMist 187. FadingMist Lv 1 1 pt. 7,569
  7. Avatar for bergie72 188. bergie72 Lv 1 1 pt. 7,560
  8. Avatar for smholst 189. smholst Lv 1 1 pt. 7,558
  9. Avatar for Craycon 190. Craycon Lv 1 1 pt. 7,551

Comments