Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Piratenpartei Deutschland 11. Piratenpartei Deutschland 2 pts. 8,976
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  4. Avatar for freefolder 14. freefolder 1 pt. 8,318
  5. Avatar for xkcd 15. xkcd 1 pt. 8,123
  6. Avatar for :) 16. :) 1 pt. 8,110
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  8. Avatar for Russian team 18. Russian team 1 pt. 7,883
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732
  1. Avatar for woobinback 191. woobinback Lv 1 1 pt. 7,551
  2. Avatar for TIENTI 192. TIENTI Lv 1 1 pt. 7,549
  3. Avatar for JWNoctis 193. JWNoctis Lv 1 1 pt. 7,499
  4. Avatar for Tac1 194. Tac1 Lv 1 1 pt. 7,488
  5. Avatar for metafolder 195. metafolder Lv 1 1 pt. 7,478
  6. Avatar for GriffonShaped 196. GriffonShaped Lv 1 1 pt. 7,469
  7. Avatar for paulcianci 197. paulcianci Lv 1 1 pt. 7,458
  8. Avatar for Gleb Ptitsyn 198. Gleb Ptitsyn Lv 1 1 pt. 7,450
  9. Avatar for chang.1518 199. chang.1518 Lv 1 1 pt. 7,423
  10. Avatar for mattrob6204 200. mattrob6204 Lv 1 1 pt. 7,420

Comments