Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  3. Avatar for freefolder 14. freefolder 1 pt. 8,318
  4. Avatar for xkcd 15. xkcd 1 pt. 8,123
  5. Avatar for :) 16. :) 1 pt. 8,110
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  7. Avatar for Russian team 18. Russian team 1 pt. 7,883
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732

  1. Avatar for jamiexq 51. jamiexq Lv 1 29 pts. 9,341
  2. Avatar for Glen B 52. Glen B Lv 1 28 pts. 9,332
  3. Avatar for YeshuaLives 53. YeshuaLives Lv 1 28 pts. 9,328
  4. Avatar for tarimo 54. tarimo Lv 1 27 pts. 9,326
  5. Avatar for shettler 55. shettler Lv 1 26 pts. 9,325
  6. Avatar for Keresto 56. Keresto Lv 1 25 pts. 9,320
  7. Avatar for Vinara 57. Vinara Lv 1 25 pts. 9,316
  8. Avatar for TomTaylor 58. TomTaylor Lv 1 24 pts. 9,308
  9. Avatar for alcor29 59. alcor29 Lv 1 23 pts. 9,307
  10. Avatar for Museka 60. Museka Lv 1 23 pts. 9,300

Comments