Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  3. Avatar for freefolder 14. freefolder 1 pt. 8,318
  4. Avatar for xkcd 15. xkcd 1 pt. 8,123
  5. Avatar for :) 16. :) 1 pt. 8,110
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  7. Avatar for Russian team 18. Russian team 1 pt. 7,883
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732

  1. Avatar for Tehnologik1 81. Tehnologik1 Lv 1 12 pts. 9,141
  2. Avatar for Deleted player 82. Deleted player pts. 9,141
  3. Avatar for weitzen 83. weitzen Lv 1 11 pts. 9,119
  4. Avatar for Antibrad 84. Antibrad Lv 1 11 pts. 9,119
  5. Avatar for Superphosphate 85. Superphosphate Lv 1 10 pts. 9,081
  6. Avatar for georg137 86. georg137 Lv 1 10 pts. 9,064
  7. Avatar for Deleted player 87. Deleted player pts. 9,039
  8. Avatar for fishercat 88. fishercat Lv 1 9 pts. 9,034
  9. Avatar for mitarcher 89. mitarcher Lv 1 9 pts. 9,022
  10. Avatar for johngran 90. johngran Lv 1 9 pts. 9,011

Comments