Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,708
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 9,691
  3. Avatar for LociOiling 3. LociOiling Lv 1 96 pts. 9,673
  4. Avatar for bertro 4. bertro Lv 1 94 pts. 9,654
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 92 pts. 9,644
  6. Avatar for markm457 6. markm457 Lv 1 90 pts. 9,643
  7. Avatar for pauldunn 7. pauldunn Lv 1 88 pts. 9,630
  8. Avatar for frood66 8. frood66 Lv 1 86 pts. 9,616
  9. Avatar for Vredeman 9. Vredeman Lv 1 84 pts. 9,603
  10. Avatar for dembones 10. dembones Lv 1 82 pts. 9,595

Comments