Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227

  1. Avatar for chan12 101. chan12 Lv 1 6 pts. 8,686
  2. Avatar for uihcv 102. uihcv Lv 1 6 pts. 8,681
  3. Avatar for rezaefar 103. rezaefar Lv 1 5 pts. 8,608
  4. Avatar for Fat Tony 104. Fat Tony Lv 1 5 pts. 8,583
  5. Avatar for joaniegirl 105. joaniegirl Lv 1 5 pts. 8,563
  6. Avatar for harvardman 106. harvardman Lv 1 5 pts. 8,533
  7. Avatar for cherry39 107. cherry39 Lv 1 5 pts. 8,503
  8. Avatar for kvasirthewise 108. kvasirthewise Lv 1 5 pts. 8,479
  9. Avatar for 341441 109. 341441 Lv 1 4 pts. 8,470
  10. Avatar for Sci1217 110. Sci1217 Lv 1 4 pts. 8,454

Comments