Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227

  1. Avatar for MicElephant 61. MicElephant Lv 1 22 pts. 9,287
  2. Avatar for randomlil 62. randomlil Lv 1 21 pts. 9,279
  3. Avatar for JayD7217 63. JayD7217 Lv 1 21 pts. 9,269
  4. Avatar for bx7gn 64. bx7gn Lv 1 20 pts. 9,269
  5. Avatar for pfirth 65. pfirth Lv 1 19 pts. 9,248
  6. Avatar for deLaCeiba 66. deLaCeiba Lv 1 19 pts. 9,248
  7. Avatar for Paulo Roque 67. Paulo Roque Lv 1 18 pts. 9,231
  8. Avatar for O Seki To 68. O Seki To Lv 1 18 pts. 9,227
  9. Avatar for diamonddays 69. diamonddays Lv 1 17 pts. 9,205
  10. Avatar for stomjoh 70. stomjoh Lv 1 17 pts. 9,202

Comments