Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227

  1. Avatar for ManVsYard 71. ManVsYard Lv 1 16 pts. 9,201
  2. Avatar for guineapig 72. guineapig Lv 1 16 pts. 9,195
  3. Avatar for gurch 73. gurch Lv 1 15 pts. 9,194
  4. Avatar for Jim Fraser 74. Jim Fraser Lv 1 15 pts. 9,187
  5. Avatar for NinjaGreg 75. NinjaGreg Lv 1 14 pts. 9,187
  6. Avatar for dbuske 76. dbuske Lv 1 14 pts. 9,185
  7. Avatar for phi16 77. phi16 Lv 1 13 pts. 9,180
  8. Avatar for WBarme1234 78. WBarme1234 Lv 1 13 pts. 9,164
  9. Avatar for Bushman 79. Bushman Lv 1 13 pts. 9,154
  10. Avatar for ViJay7019 80. ViJay7019 Lv 1 12 pts. 9,144

Comments